HORDB

ID: hor004528
Uniprot ID: P01168
Protein name: Somatostatin-14
Gene name: SST
Organism: Sus scrofa (Pig)
Family: Somatostatin family
Source: animal
Expression: [Neuronostatin]: Expressed in the pancreas and the spleen (at protein level).
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0048018 receptor ligand activity
GO BP: GO:0030334 regulation of cell migration; GO:0038170 somatostatin signaling pathway; GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0098982 GABA-ergic synapse

Sequence: AGCKNFFWKTFTSC
Length: 14(103-116)
Propeptide: MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
Signal peptide: MLSCRLQCALAALSIVLALGGVTG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secreti
Mechanism: NA
Cross BBB: YES
Target: SSTR2, SSTR5
Target Unid: P34994, A0A286ZRE5
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: 1.0卤0.2 minutes; /60 seconds ( PubMed ID: 6117506 )

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004528_AF2.pdb

hor004528_ESM.pdb

Mass:	187196	Formula:	C76H106N18O19S2
Absent amino acids:	DEHILMPQRVY	Common amino acids:	F
pI:	8.82	Basic residues:	2
Polar residues:	7	Hydrophobic residues:	5
Hydrophobicity:	2.86	Boman Index:	-970
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	7.14
Instability Index:	3065	Extinction Coefficient cystines:	5625
Absorbance 280nm:	432.69